Igf2 (Mouse) Recombinant Protein
  • Igf2 (Mouse) Recombinant Protein

Igf2 (Mouse) Recombinant Protein

Ref: AB-P8189
Igf2 (Mouse) Recombinant Protein

Información del producto

Mouse Igf2 (P09535, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Igf2
Gene Alias AL033362|Igf-2|Igf-II|M6pr|Mpr|Peg2
Gene Description insulin-like growth factor 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 mg/mL
Gene ID 16002

Enviar un mensaje


Igf2 (Mouse) Recombinant Protein

Igf2 (Mouse) Recombinant Protein