IGF2 (Human) Recombinant Protein
  • IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein

Ref: AB-P8188
IGF2 (Human) Recombinant Protein

Información del producto

Human IGF2 (P01344, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name IGF2
Gene Alias C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974
Gene Description insulin-like growth factor 2 (somatomedin A)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3481

Enviar un mensaje


IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein