Igf1 (Rat) Recombinant Protein Ver mas grande

Igf1 (Rat) Recombinant Protein

AB-P8185

Producto nuevo

Igf1 (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 ug
Gene Name Igf1
Gene Alias -
Gene Description insulin-like growth factor 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 24482

Más información

Rat Igf1 (P08025, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Igf1 (Rat) Recombinant Protein

Igf1 (Rat) Recombinant Protein