Igf1 (Mouse) Recombinant Protein
  • Igf1 (Mouse) Recombinant Protein

Igf1 (Mouse) Recombinant Protein

Ref: AB-P8184
Igf1 (Mouse) Recombinant Protein

Información del producto

Mouse Igf1 (P05017, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Igf1
Gene Alias C730016P09Rik|Igf-1|Igf-I
Gene Description insulin-like growth factor 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 16000

Enviar un mensaje


Igf1 (Mouse) Recombinant Protein

Igf1 (Mouse) Recombinant Protein