IGF1 (Human) Recombinant Protein
  • IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein

Ref: AB-P8178
IGF1 (Human) Recombinant Protein

Información del producto

Human IGF1 (P05019) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name IGF1
Gene Alias IGFI
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3479

Enviar un mensaje


IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein