IGF1 (Human) Recombinant Protein
  • IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein

Ref: AB-P8175
IGF1 (Human) Recombinant Protein

Información del producto

Human IGF1 (P05019, 48 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 500 ug
Gene Name IGF1
Gene Alias IGFI
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3479

Enviar un mensaje


IGF1 (Human) Recombinant Protein

IGF1 (Human) Recombinant Protein