IRF3 (Human) Recombinant Protein
  • IRF3 (Human) Recombinant Protein

IRF3 (Human) Recombinant Protein

Ref: AB-P8173
IRF3 (Human) Recombinant Protein

Información del producto

Human IRF3 (Q14653, 1 a.a. - 112 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IRF3
Gene Alias -
Gene Description interferon regulatory factor 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4
Gene ID 3661

Enviar un mensaje


IRF3 (Human) Recombinant Protein

IRF3 (Human) Recombinant Protein