IRF1 (Human) Recombinant Protein
  • IRF1 (Human) Recombinant Protein

IRF1 (Human) Recombinant Protein

Ref: AB-P8171
IRF1 (Human) Recombinant Protein

Información del producto

Human IRF1 (P10914, 1 a.a. - 114 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IRF1
Gene Alias IRF-1|MAR
Gene Description interferon regulatory factor 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPP
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris pH 8 (10% glycerol)
Gene ID 3659

Enviar un mensaje


IRF1 (Human) Recombinant Protein

IRF1 (Human) Recombinant Protein