IFNGR1 (Human) Recombinant Protein
  • IFNGR1 (Human) Recombinant Protein

IFNGR1 (Human) Recombinant Protein

Ref: AB-P8168
IFNGR1 (Human) Recombinant Protein

Información del producto

Human IFNGR1 (P15260, 18 a.a. - 245 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name IFNGR1
Gene Alias CD119|FLJ45734|IFNGR
Gene Description interferon gamma receptor 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3459

Enviar un mensaje


IFNGR1 (Human) Recombinant Protein

IFNGR1 (Human) Recombinant Protein