IFNG (Rhesus Macaque) Recombinant Protein
  • IFNG (Rhesus Macaque) Recombinant Protein

IFNG (Rhesus Macaque) Recombinant Protein

Ref: AB-P8167
IFNG (Rhesus Macaque) Recombinant Protein

Información del producto

Rhesus Macaque IFNG (P63310, 24 a.a. - 165 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name IFNG
Gene Alias IFN-gamma
Gene Description interferon-gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 574282

Enviar un mensaje


IFNG (Rhesus Macaque) Recombinant Protein

IFNG (Rhesus Macaque) Recombinant Protein