IFNG (Rhesus Macaque) Recombinant Protein Ver mas grande

IFNG (Rhesus Macaque) Recombinant Protein

AB-P8167

Producto nuevo

IFNG (Rhesus Macaque) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 ug
Gene Name IFNG
Gene Alias IFN-gamma
Gene Description interferon-gamma
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 574282

Más información

Rhesus Macaque IFNG (P63310, 24 a.a. - 165 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Consulta sobre un producto

IFNG (Rhesus Macaque) Recombinant Protein

IFNG (Rhesus Macaque) Recombinant Protein