IFNG (Canine) Recombinant Protein
  • IFNG (Canine) Recombinant Protein

IFNG (Canine) Recombinant Protein

Ref: AB-P8165
IFNG (Canine) Recombinant Protein

Información del producto

Canine IFNG (P42161, 24 a.a. - 166 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name IFNG
Gene Alias IFN-G|IFN-gamma
Gene Description interferon gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM MES pH 6.0 (0.1M NaCl, 1mM EDTA, 20% glycerol)
Gene ID 403801

Enviar un mensaje


IFNG (Canine) Recombinant Protein

IFNG (Canine) Recombinant Protein