Ifng (Rat) Recombinant Protein
  • Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein

Ref: AB-P8162
Ifng (Rat) Recombinant Protein

Información del producto

Rat Ifng (P01581, 23 a.a. - 155 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Ifng
Gene Alias IFNG2
Gene Description interferon gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 25712

Enviar un mensaje


Ifng (Rat) Recombinant Protein

Ifng (Rat) Recombinant Protein