Ver mas grande
Ifnb1 (Mouse) Recombinant Protein
AB-P8155
Producto nuevo
Ifnb1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Ifnb1 |
| Gene Alias | IFN-beta|IFNB|Ifb |
| Gene Description | interferon beta 1, fibroblast |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM HEPES pH 6.0 (0.5M NaCl, 10% glycerol) |
| Gene ID | 15977 |
Más información
Mouse Ifnb1 (P01575, 22 a.a. - 182 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.