Ifnb1 (Mouse) Recombinant Protein
  • Ifnb1 (Mouse) Recombinant Protein

Ifnb1 (Mouse) Recombinant Protein

Ref: AB-P8155
Ifnb1 (Mouse) Recombinant Protein

Información del producto

Mouse Ifnb1 (P01575, 22 a.a. - 182 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Ifnb1
Gene Alias IFN-beta|IFNB|Ifb
Gene Description interferon beta 1, fibroblast
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM HEPES pH 6.0 (0.5M NaCl, 10% glycerol)
Gene ID 15977

Enviar un mensaje


Ifnb1 (Mouse) Recombinant Protein

Ifnb1 (Mouse) Recombinant Protein