IFNB1 (Human) Recombinant Protein
  • IFNB1 (Human) Recombinant Protein

IFNB1 (Human) Recombinant Protein

Ref: AB-P8154
IFNB1 (Human) Recombinant Protein

Información del producto

Human IFNB1 (P01574, 23 a.a. - 187 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IFNB1
Gene Alias IFB|IFF|IFNB|MGC96956
Gene Description interferon, beta 1, fibroblast
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3456

Enviar un mensaje


IFNB1 (Human) Recombinant Protein

IFNB1 (Human) Recombinant Protein