IFNA2 (Human) Recombinant Protein
  • IFNA2 (Human) Recombinant Protein

IFNA2 (Human) Recombinant Protein

Ref: AB-P8144
IFNA2 (Human) Recombinant Protein

Información del producto

Human IFNA2 (P01563, 24 a.a. - 188 a.a.) partial recombinant protein expressed in Saccharomyces cerevisiae.
Información adicional
Size 50 ug
Gene Name IFNA2
Gene Alias IFNA|INFA2|MGC125764|MGC125765
Gene Description interferon, alpha 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3440

Enviar un mensaje


IFNA2 (Human) Recombinant Protein

IFNA2 (Human) Recombinant Protein