MOGAT2 (Human) Recombinant Protein (P01)
  • MOGAT2 (Human) Recombinant Protein (P01)

MOGAT2 (Human) Recombinant Protein (P01)

Ref: AB-H00080168-P01
MOGAT2 (Human) Recombinant Protein (P01)

Información del producto

Human MOGAT2 full-length ORF ( AAI03879.1, 1 a.a. - 284 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name MOGAT2
Gene Alias DGAT2L5|FLJ22644|MGAT2|MGC119183|MGC119184|MGC119185
Gene Description monoacylglycerol O-acyltransferase 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGYQASGKSTLGSVGNWQGFYFGGKMAETNADSILVEIFS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 80168

Enviar un mensaje


MOGAT2 (Human) Recombinant Protein (P01)

MOGAT2 (Human) Recombinant Protein (P01)