Ver mas grande
TAS2R14 (Human) Recombinant Protein (Q01)
AB-H00050840-Q01
Producto nuevo
TAS2R14 (Human) Recombinant Protein (Q01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 2 ug |
| Gene Name | TAS2R14 |
| Gene Alias | MGC125491|MGC125492|T2R14|TRB1 |
| Gene Description | taste receptor, type 2, member 14 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | HINASINGYRRNKTCSSDSSNFTRFSSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLYAIFSLSFFISVWTSERLEEN |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 50840 |
Más información
Human TAS2R14 partial ORF ( NP_076411, 151 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.