LY86 (Human) Recombinant Protein (Q01)
  • LY86 (Human) Recombinant Protein (Q01)

LY86 (Human) Recombinant Protein (Q01)

Ref: AB-H00009450-Q01
LY86 (Human) Recombinant Protein (Q01)

Información del producto

Human LY86 partial ORF ( AAH38846, 26 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name LY86
Gene Alias MD-1|MMD-1|dJ80N2.1
Gene Description lymphocyte antigen 86
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9450

Enviar un mensaje


LY86 (Human) Recombinant Protein (Q01)

LY86 (Human) Recombinant Protein (Q01)