Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
IL2RG (Human) Recombinant Protein
Abnova
IL2RG (Human) Recombinant Protein
Ref: AB-P9743
IL2RG (Human) Recombinant Protein
Contáctenos
Información del producto
Human IL2RG (P31785-1, 27 a.a. - 239 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size
100 ug
Gene Name
IL2RG
Gene Alias
CD132|IMD4|SCIDX|SCIDX1
Gene Description
interleukin 2 receptor, gamma (severe combined immunodeficiency)
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE,SPR
Immunogen Prot. Seq
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Form
Lyophilized
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Quality control testing
SEC-HPLC and Tris-Bis PAGE
Storage Buffer
Lyophilized from sterile distilled Water is >
Gene ID
3561
Enviar un mensaje
IL2RG (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*