Ver mas grande
BTN2A1 (Human) Recombinant Protein
AB-P9741
Producto nuevo
BTN2A1 (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | BTN2A1 |
| Gene Alias | BK14H9.1|BT2.1|BTF1|DJ3E1.1|FLJ36567 |
| Gene Description | butyrophilin, subfamily 2, member A1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPLA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 11120 |
Más información
Human BTN2A1 (Q7KYR7-1, 29 a.a. - 248 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.