C3 (Human) Recombinant Protein
  • C3 (Human) Recombinant Protein

C3 (Human) Recombinant Protein

Ref: AB-P9738
C3 (Human) Recombinant Protein

Información del producto

Human C3 (P01031-1, 19 a.a. - 1676 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name C3
Gene Alias ARMD9|ASP|CPAMD1
Gene Description complement component 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE
Immunogen Prot. Seq QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNKVVTEADVYITFGIRE
Form Lyophilized
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 718

Enviar un mensaje


C3 (Human) Recombinant Protein

C3 (Human) Recombinant Protein