TNFRSF11A (Human) Recombinant Protein Ver mas grande

TNFRSF11A (Human) Recombinant Protein

AB-P9736

Producto nuevo

TNFRSF11A (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 100 ug
Gene Name TNFRSF11A
Gene Alias CD265|FEO|LOH18CR1|ODFR|OFE|OPTB7|OSTS|PDB2|RANK|TRANCER
Gene Description tumor necrosis factor receptor superfamily, member 11a, NFKB activator
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
Form Lyophilized
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 8792

Más información

Human TNFRSF11A (Q9Y6Q6-1, 30 a.a. - 212 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

Consulta sobre un producto

TNFRSF11A (Human) Recombinant Protein

TNFRSF11A (Human) Recombinant Protein