LRP5 (Human) Recombinant Protein Ver mas grande

LRP5 (Human) Recombinant Protein

AB-P9734

Producto nuevo

LRP5 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 100 ug
Gene Name LRP5
Gene Alias BMND1|EVR1|EVR4|HBM|LR3|LRP7|OPPG|OPS|OPTA1|VBCH2
Gene Description low density lipoprotein receptor-related protein 5
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq EAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSS
Form Lyophilized
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 4041

Más información

Human LRP5 (O75197-1, 644 a.a. - 1263 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.

Consulta sobre un producto

LRP5 (Human) Recombinant Protein

LRP5 (Human) Recombinant Protein