CD96 (Human) Recombinant Protein Ver mas grande

CD96 (Human) Recombinant Protein

AB-P9731

Producto nuevo

CD96 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 100 ug
Gene Name CD96
Gene Alias DKFZp667E2122|MGC22596|TACTILE
Gene Description CD96 molecule
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VWEKTVNTEENVYATLGSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAVYHPQYGFYCAYGRPCESLVTFTETPENGSKWTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYNLLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSSKISSEFTYAWSVEDNGTQETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQIFDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVIVENNSTDVLVERRFTCLL
Form Lyophilized
Recomended Dilution Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 10225

Más información

Human CD96 (P40200-2, 22 a.a. - 503 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.

Consulta sobre un producto

CD96 (Human) Recombinant Protein

CD96 (Human) Recombinant Protein