MICA (Human) Recombinant Protein
  • MICA (Human) Recombinant Protein

MICA (Human) Recombinant Protein

Ref: AB-P9714
MICA (Human) Recombinant Protein

Información del producto

Human MICA (Q96QC4, 24 a.a. - 308 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Storage Conditions Store at -80C for 12 Month.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE,SPR
Immunogen Prot. Seq EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQ
Form Liquid
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer In PBS pH 7.4
Gene ID 100507436

Enviar un mensaje


MICA (Human) Recombinant Protein

MICA (Human) Recombinant Protein