Ver mas grande
RAET1E (Human) Recombinant Protein
AB-P9709
Producto nuevo
RAET1E (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | RAET1E |
| Gene Alias | LETAL|MGC125308|MGC125309|RAET1E2|ULBP4|bA350J20.7 |
| Gene Description | retinoic acid early transcript 1E |
| Storage Conditions | Store at -80ºC for 12 Month.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | HSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPD |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>ELISA<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SEC-HPLC and Tris-Bis PAGE |
| Storage Buffer | In PBS pH 7.4 |
| Gene ID | 135250 |
Más información
Human RAET1E (Q8TD07-1, 31 a.a. - 225 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.