Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
RAET1E (Human) Recombinant Protein
Abnova
RAET1E (Human) Recombinant Protein
Ref: AB-P9709
RAET1E (Human) Recombinant Protein
Contáctenos
Información del producto
Human RAET1E (Q8TD07-1, 31 a.a. - 225 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size
100 ug
Gene Name
RAET1E
Gene Alias
LETAL|MGC125308|MGC125309|RAET1E2|ULBP4|bA350J20.7
Gene Description
retinoic acid early transcript 1E
Storage Conditions
Store at -80C for 12 Month.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE,SPR
Immunogen Prot. Seq
HSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPD
Form
Liquid
Recomended Dilution
Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Quality control testing
SEC-HPLC and Tris-Bis PAGE
Storage Buffer
In PBS pH 7.4
Gene ID
135250
Enviar un mensaje
RAET1E (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*