RAET1E (Human) Recombinant Protein
  • RAET1E (Human) Recombinant Protein

RAET1E (Human) Recombinant Protein

Ref: AB-P9709
RAET1E (Human) Recombinant Protein

Información del producto

Human RAET1E (Q8TD07-1, 31 a.a. - 225 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name RAET1E
Gene Alias LETAL|MGC125308|MGC125309|RAET1E2|ULBP4|bA350J20.7
Gene Description retinoic acid early transcript 1E
Storage Conditions Store at -80C for 12 Month.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE,SPR
Immunogen Prot. Seq HSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPD
Form Liquid
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer In PBS pH 7.4
Gene ID 135250

Enviar un mensaje


RAET1E (Human) Recombinant Protein

RAET1E (Human) Recombinant Protein