FCRL5 (Human) Recombinant Protein
  • FCRL5 (Human) Recombinant Protein

FCRL5 (Human) Recombinant Protein

Ref: AB-P9707
FCRL5 (Human) Recombinant Protein

Información del producto

Human FCRL5 (AAK93971, 16 a.a. - 851 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 100 ug
Gene Name FCRL5
Gene Alias BXMAS1|CD307|DKFZp667E2019|DKFZp667F216|FCRH5|FLJ00333|FLJ00397|IRTA2|MGC119590|MGC119592|MGC119593|PRO820
Gene Description Fc receptor-like 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,Func,SDS-PAGE
Immunogen Prot. Seq QFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVI
Form Lyophilized
Recomended Dilution Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SEC-HPLC and Tris-Bis PAGE
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 83416

Enviar un mensaje


FCRL5 (Human) Recombinant Protein

FCRL5 (Human) Recombinant Protein