CD74 (Human) Recombinant Protein Ver mas grande

CD74 (Human) Recombinant Protein

AB-P9678

Producto nuevo

CD74 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name CD74
Gene Alias DHLAG|HLADG|Ia-GAMMA
Gene Description CD74 molecule, major histocompatibility complex, class II invariant chain
Storage Conditions Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.1 M NaCl and 30% glycerol)
Gene ID 972

Más información

Human CD74 (P04233, 73 a.a. - 232 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Consulta sobre un producto

CD74 (Human) Recombinant Protein

CD74 (Human) Recombinant Protein