CD74 (Human) Recombinant Protein
  • CD74 (Human) Recombinant Protein

CD74 (Human) Recombinant Protein

Ref: AB-P9678
CD74 (Human) Recombinant Protein

Información del producto

Human CD74 (P04233, 73 a.a. - 232 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CD74
Gene Alias DHLAG|HLADG|Ia-GAMMA
Gene Description CD74 molecule, major histocompatibility complex, class II invariant chain
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (1 mM DTT, 0.1 M NaCl and 30% glycerol)
Gene ID 972

Enviar un mensaje


CD74 (Human) Recombinant Protein

CD74 (Human) Recombinant Protein