Ver mas grande
CD244 (Human) Recombinant Protein
AB-P9672
Producto nuevo
CD244 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CD244 |
| Gene Alias | 2B4|NAIL|NKR2B4|Nmrk|SLAMF4 |
| Gene Description | CD244 molecule, natural killer cell receptor 2B4 |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ADLGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 51744 |
Más información
Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial recombinant protein with hIgG-His tag at C-terminus expressed in Sf9 cells.