Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CD244 (Human) Recombinant Protein
Abnova
CD244 (Human) Recombinant Protein
Ref: AB-P9671
CD244 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial recombinant protein with His tag at N-terminus expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
CD244
Gene Alias
2B4|NAIL|NKR2B4|Nmrk|SLAMF4
Gene Description
CD244 molecule, natural killer cell receptor 2B4
Storage Conditions
Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSHGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWP
Form
Liquid
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
In 20mM Tris-HCl pH 8.0 (0.4 M Urea)
Gene ID
51744
Enviar un mensaje
CD244 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*