CD9 (Human) Recombinant Protein Ver mas grande

CD9 (Human) Recombinant Protein

AB-P9655

Producto nuevo

CD9 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name CD9
Gene Alias 5H9|BA2|BTCC-1|DRAP-27|GIG2|MIC3|MRP-1|P24|TSPAN29
Gene Description CD9 molecule
Storage Conditions Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (1 mM DTT and 20% glycerol)
Gene ID 928

Más información

Human CD9 (P21926, 112 a.a. - 195 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Consulta sobre un producto

CD9 (Human) Recombinant Protein

CD9 (Human) Recombinant Protein