Cd80 (Mouse) Recombinant Protein
  • Cd80 (Mouse) Recombinant Protein

Cd80 (Mouse) Recombinant Protein

Ref: AB-P9654
Cd80 (Mouse) Recombinant Protein

Información del producto

Mouse Cd80 (Q00609, 37 a.a. - 246 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name Cd80
Gene Alias B7-1|B7.1|Cd28l|Ly-53|Ly53|MIC17|TS/A-1
Gene Description CD80 antigen
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq DVDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 12519

Enviar un mensaje


Cd80 (Mouse) Recombinant Protein

Cd80 (Mouse) Recombinant Protein