CD8A (Human) Recombinant Protein Ver mas grande

CD8A (Human) Recombinant Protein

AB-P9651

Producto nuevo

CD8A (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name CD8A
Gene Alias CD8|Leu2|MAL|p32
Gene Description CD8a molecule
Storage Conditions Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ADPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDHHHHHH
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 925

Más información

Human CD8A (P01732, 22 a.a. - 182 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Consulta sobre un producto

CD8A (Human) Recombinant Protein

CD8A (Human) Recombinant Protein