CD7 (Human) Recombinant Protein
  • CD7 (Human) Recombinant Protein

CD7 (Human) Recombinant Protein

Ref: AB-P9650
CD7 (Human) Recombinant Protein

Información del producto

Human CD7 (P09564, 26 a.a. - 180 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name CD7
Gene Alias GP40|LEU-9|TP41|Tp40
Gene Description CD7 molecule
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADLAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 924

Enviar un mensaje


CD7 (Human) Recombinant Protein

CD7 (Human) Recombinant Protein