Cd14 (Mouse) Recombinant Protein
  • Cd14 (Mouse) Recombinant Protein

Cd14 (Mouse) Recombinant Protein

Ref: AB-P9630
Cd14 (Mouse) Recombinant Protein

Información del producto

Mouse Cd14 (P10810, 16 a.a - 366 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name Cd14
Gene Alias -
Gene Description CD14 antigen
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 12475

Enviar un mensaje


Cd14 (Mouse) Recombinant Protein

Cd14 (Mouse) Recombinant Protein