Ver mas grande
CDK5RAP3 (Human) Recombinant Protein
AB-P9625
Producto nuevo
CDK5RAP3 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CDK5RAP3 |
| Gene Alias | C53|HSF-27|IC53|LZAP|MST016|OK/SW-cl.114 |
| Gene Description | CDK5 regulatory subunit associated protein 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGN |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (1 mM DTT and 20% glycerol) |
| Gene ID | 80279 |
Más información
Human CDK5RAP3 (Q96JB5, 1 a.a. - 506 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.