CFAP36 (Human) Recombinant Protein
  • CFAP36 (Human) Recombinant Protein

CFAP36 (Human) Recombinant Protein

Ref: AB-P9623
CFAP36 (Human) Recombinant Protein

Información del producto

Human CFAP36 (Q96G28, 1 a.a. - 342 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCDC104
Gene Alias MGC15407
Gene Description coiled-coil domain containing 104
Storage Conditions Store at 2C to 8C for 2-4 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLEGYLKEIGINEDQFQEACTSPLAKTHTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLTDGSDVVSDLEHEEMKILREVLRKSKEEYDQEEERKRKKQLSEAKTEEPTVHSSEAAIMNNSQGDGEHFAHPPSEVKMHFANQSIEPLGRKVE
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol)
Gene ID 112942

Enviar un mensaje


CFAP36 (Human) Recombinant Protein

CFAP36 (Human) Recombinant Protein