Ver mas grande
SVBP (Human) Recombinant Protein
AB-P9617
Producto nuevo
SVBP (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CCDC23 |
| Gene Alias | - |
| Gene Description | coiled-coil domain containing 23 |
| Storage Conditions | Store at 2ºC to 8ºC for 2-4 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSEFMDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (1 mM DTT and 20% glycerol) |
| Gene ID | 374969 |
Más información
Human SVBP (Q8N300, 1 a.a. - 66 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.