CDK2AP2 (Human) Recombinant Protein
  • CDK2AP2 (Human) Recombinant Protein

CDK2AP2 (Human) Recombinant Protein

Ref: AB-P9600
CDK2AP2 (Human) Recombinant Protein

Información del producto

Human CDK2AP2 (O75956, 1 a.a. - 126 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CDK2AP2
Gene Alias DOC-1R|FLJ10636|p14
Gene Description cyclin-dependent kinase 2 associated protein 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.2 M NaCl, 2mM DTT and 50% glycerol)
Gene ID 10263

Enviar un mensaje


CDK2AP2 (Human) Recombinant Protein

CDK2AP2 (Human) Recombinant Protein