CDC25A (Human) Recombinant Protein
  • CDC25A (Human) Recombinant Protein

CDC25A (Human) Recombinant Protein

Ref: AB-P9592
CDC25A (Human) Recombinant Protein

Información del producto

Human CDC25A (P30304, 1 a.a. - 524 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 5 ug
Gene Name CDC25A
Gene Alias CDC25A2
Gene Description cell division cycle 25 homolog A (S. pombe)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFV
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (0.2 M NaCl, 5 mM DTT, 1 mM EDTA and 20% glycerol)
Gene ID 993

Enviar un mensaje


CDC25A (Human) Recombinant Protein

CDC25A (Human) Recombinant Protein