Ver mas grande
CDA (Human) Recombinant Protein
AB-P9591
Producto nuevo
CDA (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CDA |
| Gene Alias | CDD |
| Gene Description | cytidine deaminase |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (100 mM NaCl, 1 mM DTT, 2 mM EDTA and 40% glycerol) |
| Gene ID | 978 |
Más información
Human CDA (P32320, 1 a.a. - 146 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.