Ccl25 (Mouse) Recombinant Protein Ver mas grande

Ccl25 (Mouse) Recombinant Protein

AB-P9589

Producto nuevo

Ccl25 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name Ccl25
Gene Alias AI852536|CKb15|Scya25|TECK
Gene Description chemokine (C-C motif) ligand 25
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is 0.5 mg/mL
Gene ID 20300

Más información

Mouse Ccl25 (O35903, 24 a.a. - 144 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Ccl25 (Mouse) Recombinant Protein

Ccl25 (Mouse) Recombinant Protein