Ccl17 (Mouse) Recombinant Protein
  • Ccl17 (Mouse) Recombinant Protein

Ccl17 (Mouse) Recombinant Protein

Ref: AB-P9584
Ccl17 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl17 (F6R5P4, 34 a.a. - 103 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl17
Gene Alias ABCD-2|Scya17|Scya17l|TARC
Gene Description chemokine (C-C motif) ligand 17
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is 0.5 mg/mL
Gene ID 20295

Enviar un mensaje


Ccl17 (Mouse) Recombinant Protein

Ccl17 (Mouse) Recombinant Protein