SDF2 (Human) Recombinant Protein
  • SDF2 (Human) Recombinant Protein

SDF2 (Human) Recombinant Protein

Ref: AB-P9581
SDF2 (Human) Recombinant Protein

Información del producto

Human SDF2 (Q99470, 19 a.a. - 211 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name SDF2
Gene Alias -
Gene Description stromal cell-derived factor 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPSSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAELHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 50mM Tris-HCl pH 8.0 (0.1 M NaCl, 0.1 mM PMSF, 0.5 mM EDTA and 10% glycerol)
Gene ID 6388

Enviar un mensaje


SDF2 (Human) Recombinant Protein

SDF2 (Human) Recombinant Protein