Ver mas grande
SDF2 (Human) Recombinant Protein
AB-P9581
Producto nuevo
SDF2 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | SDF2 |
| Gene Alias | - |
| Gene Description | stromal cell-derived factor 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ADPSSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAELHHHHHH |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 50mM Tris-HCl pH 8.0 (0.1 M NaCl, 0.1 mM PMSF, 0.5 mM EDTA and 10% glycerol) |
| Gene ID | 6388 |
Más información
Human SDF2 (Q99470, 19 a.a. - 211 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.