Ccxl12 (Mouse) Recombinant Protein
  • Ccxl12 (Mouse) Recombinant Protein

Ccxl12 (Mouse) Recombinant Protein

Ref: AB-P9576
Ccxl12 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl12 (P40224, 22 a.a. - 93 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Cxcl12
Gene Alias AI174028|PBSF|PBSF/SDF-1|SDF-1|Scyb12|Sdf1|Sdf1a|Sdf1b|TLSF|TLSF-a|TLSF-b|TPAR1
Gene Description chemokine (C-X-C motif) ligand 12
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is 0.5 mg/mL
Gene ID 20315

Enviar un mensaje


Ccxl12 (Mouse) Recombinant Protein

Ccxl12 (Mouse) Recombinant Protein