PPBP (Human) Recombinant Protein
  • PPBP (Human) Recombinant Protein

PPBP (Human) Recombinant Protein

Ref: AB-P9554
PPBP (Human) Recombinant Protein

Información del producto

Human PPBP (P02775, 59 a.a. - 128 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name PPBP
Gene Alias B-TG1|Beta-TG|CTAP-III|CTAP3|CTAPIII|CXCL7|LA-PF4|LDGF|MDGF|NAP-2|PBP|SCYB7|TC1|TC2|TGB|TGB1|THBGB|THBGB1
Gene Description pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 5473

Enviar un mensaje


PPBP (Human) Recombinant Protein

PPBP (Human) Recombinant Protein