CCL19 (Human) Recombinant Protein
  • CCL19 (Human) Recombinant Protein

CCL19 (Human) Recombinant Protein

Ref: AB-P9544
CCL19 (Human) Recombinant Protein

Información del producto

Human CCL19 (Q99731, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL19
Gene Alias CKb11|ELC|MGC34433|MIP-3b|MIP3B|SCYA19
Gene Description chemokine (C-C motif) ligand 19
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 6363

Enviar un mensaje


CCL19 (Human) Recombinant Protein

CCL19 (Human) Recombinant Protein