Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CCL3 (Human) Recombinant Protein
Abnova
CCL3 (Human) Recombinant Protein
Ref: AB-P9535
CCL3 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein with His tag at N-terminus expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
CCL3
Gene Alias
G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
Gene Description
chemokine (C-C motif) ligand 3
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Form
Liquid
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
In 10 mM Sodium Citrate buffer pH3.5 (20% glycerol)
Gene ID
6348
Enviar un mensaje
CCL3 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*