Ver mas grande
CCL3 (Human) Recombinant Protein
AB-P9535
Producto nuevo
CCL3 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CCL3 |
| Gene Alias | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
| Gene Description | chemokine (C-C motif) ligand 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 10 mM Sodium Citrate buffer pH3.5 (20% glycerol) |
| Gene ID | 6348 |
Más información
Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.