Ccl28 (Mouse) Recombinant Protein
  • Ccl28 (Mouse) Recombinant Protein

Ccl28 (Mouse) Recombinant Protein

Ref: AB-P9528
Ccl28 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl28 (Q9JIL2, 20 a.a. - 130 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl28
Gene Alias CCK1|MEC|Scya28
Gene Description chemokine (C-C motif) ligand 28
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 56838

Enviar un mensaje


Ccl28 (Mouse) Recombinant Protein

Ccl28 (Mouse) Recombinant Protein