Ccl22 (Rat) Recombinant Protein
  • Ccl22 (Rat) Recombinant Protein

Ccl22 (Rat) Recombinant Protein

Ref: AB-P9525
Ccl22 (Rat) Recombinant Protein

Información del producto

Rat Ccl22 (Q5I0L5, 25 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl22
Gene Alias MGC108943|Mdc|Scya22
Gene Description chemokine (C-C motif) ligand 22
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 117551

Enviar un mensaje


Ccl22 (Rat) Recombinant Protein

Ccl22 (Rat) Recombinant Protein